Monoclonal antibody for SUR1 and SUR2B
SMC-432D	Stressmarq	0.1mg	EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Iga Monoclonal Laboratories manufactures the iga monoclonal protien reagents distributed by Genprice. The Iga Monoclonal Protien reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Monoclonal Group: Protien

True Blue Chloride
Toronto Research Chemicals	100mg	EUR 11200
Description: 71431-30-6

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Protien information

Monoclonal Mouse Anti-Human IgA
C010208-1mg	Unibiotest	1mg	EUR 322.8

Recombinant Human ETV4 Protien, GST-tagged
ETV4-712H	Creative BioMart	25ug	EUR 255.2
Description: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Recombinant Human ACO2 Protien, His-tagged
ACO2-095H	Creative BioMart	25ug	EUR 255.2
Description: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Recombinant Human FJX1 Protien, His-tagged
FJX1-561H	Creative BioMart	25ug	EUR 255.2
Description: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

PID/MTA2 (Metastasis assiciated protien MTA2)
MBS395660-01mg	MyBiosource	0.1mg	EUR 660

PID/MTA2 (Metastasis assiciated protien MTA2)
MBS395660-5x01mg	MyBiosource	5x0.1mg	EUR 2810

Recombinant Human MMP7 Protien, GST-tagged
MMP7-395H	Creative BioMart	25ug	EUR 255.2
Description: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Recombinant Human MMP8 Protien, His-tagged
MMP8-123H	Creative BioMart	25ug	EUR 255.2
Description: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Recombinant Human RELA Protien, GST-tagged
RELA-729H	Creative BioMart	25ug	EUR 255.2
Description: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Recombinant Human PPIF Protien, His-tagged
PPIF-143H	Creative BioMart	25ug	EUR 255.2
Description: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Recombinant Human TPM2 Protien, GST-tagged
TPM2-317H	Creative BioMart	25ug	EUR 255.2
Description: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Mouse Anti Monkey Iga Monoclonal Antibody
DMABT-48823MM	Creative Diagnostics	0.25 mg	EUR 567
Description: Mouse

Mouse Anti Human Iga Monoclonal Antibody
CABT-48820MH	Creative Diagnostics	1 mg	EUR 546
Description: Mouse

Mouse Anti Horse Iga Monoclonal Antibody
DMABT-51963MH	Creative Diagnostics	2 ml	EUR 546
Description: Mouse

Mouse anti Human IgA Monoclonal Antibody
MBS460953-01mg	MyBiosource	0.1mg	EUR 280

Mouse anti Human IgA Monoclonal Antibody
MBS460953-5x01mg	MyBiosource	5x0.1mg	EUR 1215

Mouse anti Human IgA Monoclonal Antibody
MBS460954-01mg	MyBiosource	0.1mg	EUR 280