Monoclonal PP2A alpha and beta Antibody |
AMM03147G |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Chicken Monoclonal Laboratories manufactures the chicken monoclonal protocol reagents distributed by Genprice. The Chicken Monoclonal Protocol reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact chicken monoclonal. Other Chicken products are available in stock. Specificity: Chicken Category: Monoclonal Group: Protocol
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 495.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 482.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Protocol information
Ovalbumin (OVA) Monoclonal Antibody (Chicken), FITC |
4-MAB459Ge21-FITC |
Cloud-Clone |
-
EUR 351.60
-
EUR 3115.20
-
EUR 886.80
-
EUR 440.40
-
EUR 232.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Chicken Ovalbumin (OVA). This antibody is labeled with FITC. |
Interleukin 2 (IL2) Monoclonal Antibody (Chicken) |
4-MAA073Ga21 |
Cloud-Clone |
-
EUR 301.20
-
EUR 3106.80
-
EUR 771.60
-
EUR 380.40
-
EUR 259.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Chicken Interleukin 2 (IL2) |
Interleukin 8 (IL8) Monoclonal Antibody (Chicken) |
4-MAA080Ga22 |
Cloud-Clone |
-
EUR 283.20
-
EUR 2805.60
-
EUR 703.20
-
EUR 352.80
-
EUR 250.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Chicken Interleukin 8 (IL8) |
Cyclin D1 (CCND1) Monoclonal Antibody (Chicken), PE |
4-MAA585Ga21-PE |
Cloud-Clone |
-
EUR 362.40
-
EUR 3271.20
-
EUR 925.20
-
EUR 456.00
-
EUR 237.60
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Chicken Cyclin D1 (CCND1). This antibody is labeled with PE. |
Mouse Anti Chicken Cd4 Monoclonal Antibody,RPE |
DMABT-45066MC |
Creative Diagnostics |
100 TEST |
EUR 1132.8 |
Mouse Anti Chicken Cd5 Monoclonal Antibody,RPE |
DMABT-45184MC |
Creative Diagnostics |
100 TEST |
EUR 1132.8 |
HRP*Monoclonal Mouse Anti- Chicken IgM(u chain) |
C030263-10ml |
Unibiotest |
10ml |
EUR 2148 |
HRP*Monoclonal Mouse Anti- Chicken IgM(u chain) |
C030263-1ml |
Unibiotest |
1ml |
EUR 424.8 |
Interferon Beta (IFNb) Monoclonal Antibody (Chicken) |
4-MAA222Ga24 |
Cloud-Clone |
-
EUR 301.20
-
EUR 3106.80
-
EUR 771.60
-
EUR 380.40
-
EUR 259.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Chicken Interferon Beta (IFNb) |
Interferon Beta (IFNb) Monoclonal Antibody (Chicken) |
4-MAA222Ga26 |
Cloud-Clone |
-
EUR 301.20
-
EUR 3106.80
-
EUR 771.60
-
EUR 380.40
-
EUR 259.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Chicken Interferon Beta (IFNb) |
Interferon Beta (IFNb) Monoclonal Antibody (Chicken) |
4-MAA222Ga21 |
Cloud-Clone |
-
EUR 301.20
-
EUR 3106.80
-
EUR 771.60
-
EUR 380.40
-
EUR 259.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Chicken Interferon Beta (IFNb) |
Cyclin D1 (CCND1) Monoclonal Antibody (Chicken), APC |
4-MAA585Ga21-APC |
Cloud-Clone |
-
EUR 422.40
-
EUR 4059.60
-
EUR 1126.80
-
EUR 540.00
-
EUR 267.60
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Chicken Cyclin D1 (CCND1). This antibody is labeled with APC. |
Cyclin D1 (CCND1) Monoclonal Antibody (Chicken), Cy3 |
4-MAA585Ga21-Cy3 |
Cloud-Clone |
-
EUR 513.60
-
EUR 5362.80
-
EUR 1453.20
-
EUR 670.80
-
EUR 306.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Chicken Cyclin D1 (CCND1). This antibody is labeled with Cy3. |
Cyclin D1 (CCND1) Monoclonal Antibody (Chicken), HRP |
4-MAA585Ga21-HRP |
Cloud-Clone |
-
EUR 386.40
-
EUR 3537.60
-
EUR 996.00
-
EUR 488.40
-
EUR 252.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Chicken Cyclin D1 (CCND1). This antibody is labeled with HRP. |
Mouse Anti Chicken Cd4 Monoclonal Antibody,FITC |
DMABT-45064MC |
Creative Diagnostics |
0.1 mg |
EUR 1057.2 |
Mouse Anti Chicken Cd5 Monoclonal Antibody,FITC |
DMABT-45182MC |
Creative Diagnostics |
0.1 mg |
EUR 1057.2 |
Mouse Anti Chicken Cd8a Monoclonal Antibody,RPE |
DMABT-51946MC |
Creative Diagnostics |
0.1 mg |
EUR 1132.8 |