Mouse monoclonal Anti-Foot and mouth disease virus non-structural proteins (NSP) IgG |
FMDOV12-M |
Alpha Diagnostics |
100 ug |
EUR 578.4 |
Iga Monoclonal Laboratories manufactures the iga monoclonal proteins causes reagents distributed by Genprice. The Iga Monoclonal Proteins Causes reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Monoclonal Group: Proteins Causes
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Proteins Causes information
Mouse Anti Monkey Iga Monoclonal Antibody,Biotin |
DMABT-48822MM |
Creative Diagnostics |
0.25 mg |
EUR 1070.4 |
Anti-Mouse IgA, Rabbit Monoclonal Antibody |
A1787-50 |
Biovision |
each |
EUR 444 |
Rabbit Anti Human JUN Monoclonal Clone IGA-10 |
IRBAHUJUNIGA10C100UL |
Innovative research |
each |
EUR 496 |
|
Description: Rabbit Anti Human JUN Monoclonal Clone IGA-10 |
Monoclonal Anti-Green Fluorescent Proteins (GFP, A. victoria) protein IgG-HRP conjugate |
GFP12-HRP |
Alpha Diagnostics |
0.5 ml |
EUR 489.6 |
Monoclonal Anti-Red Fluorescent Proteins/Tag (RFP-tag; Discosoma sea anemomone) IgG |
RFP12-M |
Alpha Diagnostics |
100 ug |
EUR 578.4 |
Monoclonal Anti-Green Fluorescent Proteins (GFP, A. victoria) protein IgG-FITC conjugate |
GFP12-FITC |
Alpha Diagnostics |
0.5 ml |
EUR 489.6 |
Monoclonal Anti-Green Fluorescent Proteins (GFP, A. victoria) protein IgG-Biotin conjugate |
GFP12-BTN |
Alpha Diagnostics |
0.5 ml |
EUR 489.6 |
Mouse monoclonal Anti-Foot and mouth disease virus non-structural proteins (NSP) IgG |
FMDOV12-M |
Alpha Diagnostics |
100 ug |
EUR 578.4 |
Mouse Anti-HDM IgA Monoclonal Antibody, Clone G4H9G12 |
7132 |
Chondrex |
1 mg/ml x 0.1 ml |
EUR 406.26 |
Description: Mouse Anti-HDM IgA Monoclonal Antibody |
Monoclonal Anti-Green Fluorescent Proteins (GFP, A. victoria) protein IgG-Alk Phos (AP) conjugate |
GFP12-AP |
Alpha Diagnostics |
0.5 ml |
EUR 489.6 |
Mouse Anti-Ovalbumin IgA Monoclonal Antibody, Clone 2G12E12 |
7090 |
Chondrex |
1 mg/ml x 0.1 ml |
EUR 406.26 |
Description: Mouse Anti-Ovalbumin IgA Monoclonal Antibody |
Anti-Human IgA (?1 & ?2) Rabbit Monoclonal Antibody |
A1796-50 |
Biovision |
each |
EUR 352.8 |
Monoclonal CD79a (B-Cell Marker) Antibody, Clone: IGA/764 |
AMM01637G |
Leading Biology |
7 ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker). The antibodies are raised in Mouse and are from clone IGA/764. This antibody is applicable in IHC, IF, FC |
Monoclonal CD79a (B-Cell Marker) Antibody, Clone: IGA/515 |
AMM01640G |
Leading Biology |
7 ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker). The antibodies are raised in Mouse and are from clone IGA/515. This antibody is applicable in IHC, IF, FC |
Rat Anti Mouse Iga Heavy Chain Monoclonal Antibody |
CABT-54649RM |
Creative Diagnostics |
0.25 mg |
EUR 651.6 |
Mouse Anti Rat Iga Heavy Chain Monoclonal Antibody |
DMABT-49899MR |
Creative Diagnostics |
0.25 mg |
EUR 651.6 |