Iga Monoclonal Proteins Causes

Mouse monoclonal Anti-Foot and mouth disease virus non-structural proteins (NSP) IgG
FMDOV12-M 100 ug
EUR 578.4

Iga Monoclonal Laboratories manufactures the iga monoclonal proteins causes reagents distributed by Genprice. The Iga Monoclonal Proteins Causes reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Monoclonal Group: Proteins Causes

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Proteins Causes information

Mouse Anti Monkey Iga Monoclonal Antibody,Biotin
DMABT-48822MM 0.25 mg
EUR 1070.4

Mouse Anti Bovine/Ovine Iga Monoclonal Antibody
DMABT-51900MB 2 ml
EUR 889.2

Anti-Mouse IgA, Rabbit Monoclonal Antibody
A1787-50 each
EUR 444

Rabbit Anti Human JUN Monoclonal Clone IGA-10
IRBAHUJUNIGA10C100UL each
EUR 496
Description: Rabbit Anti Human JUN Monoclonal Clone IGA-10

Monoclonal Anti-Green Fluorescent Proteins (GFP, A. victoria) protein IgG-HRP conjugate
GFP12-HRP 0.5 ml
EUR 489.6

Monoclonal Anti-Red Fluorescent Proteins/Tag (RFP-tag; Discosoma sea anemomone) IgG
RFP12-M 100 ug
EUR 578.4

Monoclonal Anti-Green Fluorescent Proteins (GFP, A. victoria) protein IgG-FITC conjugate
GFP12-FITC 0.5 ml
EUR 489.6

Monoclonal Anti-Green Fluorescent Proteins (GFP, A. victoria) protein IgG-Biotin conjugate
GFP12-BTN 0.5 ml
EUR 489.6

Mouse monoclonal Anti-Foot and mouth disease virus non-structural proteins (NSP) IgG
FMDOV12-M 100 ug
EUR 578.4

Mouse Anti-HDM IgA Monoclonal Antibody, Clone G4H9G12
7132 1 mg/ml x 0.1 ml
EUR 406.26
Description: Mouse Anti-HDM IgA Monoclonal Antibody

Monoclonal Anti-Green Fluorescent Proteins (GFP, A. victoria) protein IgG-Alk Phos (AP) conjugate
GFP12-AP 0.5 ml
EUR 489.6

Mouse Anti-Ovalbumin IgA Monoclonal Antibody, Clone 2G12E12
7090 1 mg/ml x 0.1 ml
EUR 406.26
Description: Mouse Anti-Ovalbumin IgA Monoclonal Antibody

Anti-Human IgA (?1 & ?2) Rabbit Monoclonal Antibody
A1796-50 each
EUR 352.8

Monoclonal CD79a (B-Cell Marker) Antibody, Clone: IGA/764
AMM01637G 7 ml
EUR 580.8
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker). The antibodies are raised in Mouse and are from clone IGA/764. This antibody is applicable in IHC, IF, FC

Monoclonal CD79a (B-Cell Marker) Antibody, Clone: IGA/515
AMM01640G 7 ml
EUR 580.8
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker). The antibodies are raised in Mouse and are from clone IGA/515. This antibody is applicable in IHC, IF, FC

Rat Anti Mouse Iga Heavy Chain Monoclonal Antibody
CABT-54649RM 0.25 mg
EUR 651.6

Mouse Anti Rat Iga Heavy Chain Monoclonal Antibody
DMABT-49899MR 0.25 mg
EUR 651.6