Antibodies For Puppies

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Dog Antibody Laboratories manufactures the antibodies for puppies reagents distributed by Genprice. The Antibodies For Puppies reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact dog Antibody. Other Antibodies products are available in stock. Specificity: Antibodies Category: For Group: Puppies

True Blue

5x5(mg
EUR 2705

JBS True Blue

300µl
EUR 13.7

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

JBS True Blue

300 µl
EUR 16
Description: JBS True Blue

True north Cryobox1.5/2mLNatural

PK10
EUR 129.6

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

1mg Ask for price
Description: 108321-12-6

Puppies information

Monoclonal antibodies for LH (25mIU/ml) conjugate

MBS596272-1mg 1mg
EUR 480

Monoclonal antibodies for LH (25mIU/ml) conjugate

MBS596272-2mg 2mg
EUR 700

Monoclonal antibodies for LH (25mIU/ml) conjugate

MBS596272-5mg 5mg
EUR 1505

Negative Control for Rabbit Monoclonal Antibodies

MBS4380418-002mgWithBSAAzideat02mgmL 0.02mg(WithBSA&Azideat0.2mg/mL)
EUR 230

Negative Control for Rabbit Monoclonal Antibodies

MBS4380418-01mgWithBSAAzideat02mgmL 0.1mg(WithBSA&Azideat0.2mg/mL)
EUR 405

Negative Control for Rabbit Monoclonal Antibodies

MBS4380418-01mgWithoutBSAAzideat1mgmL 0.1mg(WithoutBSA&Azideat1mg/mL)
EUR 405

Negative Control for Rabbit Monoclonal Antibodies

MBS4380418-5x01mgWithBSAAzideat02mgmL 5x0.1mg(WithBSA&Azideat0.2mg/mL)
EUR 1725

Negative Control for Rabbit Monoclonal Antibodies

MBS4380418-5x01mgWithoutBSAAzideat1mgmL 5x0.1mg(WithoutBSA&Azideat1mg/mL)
EUR 1725

Paired monoclonal antibodies for stool S. typhi test

MBS596003-1mg 1mg
EUR 360

Paired monoclonal antibodies for stool S. typhi test

MBS596003-2mg 2mg
EUR 550

Paired monoclonal antibodies for stool S. typhi test

MBS596003-5mg 5mg
EUR 1140

Antigen-Antibody Pen For Rat Primary antibodies

PEN-R10 1
EUR 242.4

Antigen-Antibody Pen For Goat Primary antibodies

PEN-G3 1
EUR 242.4

Antigen-Antibody Pen For Human Primary antibodies

PEN-H7 1
EUR 242.4

Antigen-Antibody Pen For Mouse Primary antibodies

PEN-M2 1
EUR 242.4

Antigen-Antibody Pen For Sheep Primary antibodies

PEN-S4 1
EUR 242.4

ELISA Kit for Anti-Islet Cell Antibodies (ICA)

AED246Hu 96Т
EUR 870