Monoclonal antibody for SUR1 and SUR2B |
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Dog Antibody Laboratories manufactures the antibodies for puppies reagents distributed by Genprice. The Antibodies For Puppies reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact dog Antibody. Other Antibodies products are available in stock. Specificity: Antibodies Category: For Group: Puppies
JBS True Blue |
MiTeGen |
300 Βµl |
EUR 16 |
Description: JBS True Blue |
Human True insulin ELISA Kit |
MyBiosource |
48-Strip-Wells-(Competitive) |
EUR 485 |
Puppies information
Monoclonal antibodies for LH (25mIU/ml) conjugate |
MBS596272-1mg |
MyBiosource |
1mg |
EUR 480 |
Monoclonal antibodies for LH (25mIU/ml) conjugate |
MBS596272-2mg |
MyBiosource |
2mg |
EUR 700 |
Monoclonal antibodies for LH (25mIU/ml) conjugate |
MBS596272-5mg |
MyBiosource |
5mg |
EUR 1505 |
Negative Control for Rabbit Monoclonal Antibodies |
MBS4380418-002mgWithBSAAzideat02mgmL |
MyBiosource |
0.02mg(WithBSA&Azideat0.2mg/mL) |
EUR 230 |
Negative Control for Rabbit Monoclonal Antibodies |
MBS4380418-01mgWithBSAAzideat02mgmL |
MyBiosource |
0.1mg(WithBSA&Azideat0.2mg/mL) |
EUR 405 |
Negative Control for Rabbit Monoclonal Antibodies |
MBS4380418-01mgWithoutBSAAzideat1mgmL |
MyBiosource |
0.1mg(WithoutBSA&Azideat1mg/mL) |
EUR 405 |
Negative Control for Rabbit Monoclonal Antibodies |
MBS4380418-5x01mgWithBSAAzideat02mgmL |
MyBiosource |
5x0.1mg(WithBSA&Azideat0.2mg/mL) |
EUR 1725 |
Negative Control for Rabbit Monoclonal Antibodies |
MBS4380418-5x01mgWithoutBSAAzideat1mgmL |
MyBiosource |
5x0.1mg(WithoutBSA&Azideat1mg/mL) |
EUR 1725 |
Paired monoclonal antibodies for stool S. typhi test |
MBS596003-1mg |
MyBiosource |
1mg |
EUR 360 |
Paired monoclonal antibodies for stool S. typhi test |
MBS596003-2mg |
MyBiosource |
2mg |
EUR 550 |
Paired monoclonal antibodies for stool S. typhi test |
MBS596003-5mg |
MyBiosource |
5mg |
EUR 1140 |
Antigen-Antibody Pen For Rat Primary antibodies |
PEN-R10 |
Alpha Diagnostics |
1 |
EUR 242.4 |
Antigen-Antibody Pen For Goat Primary antibodies |
PEN-G3 |
Alpha Diagnostics |
1 |
EUR 242.4 |
Antigen-Antibody Pen For Human Primary antibodies |
PEN-H7 |
Alpha Diagnostics |
1 |
EUR 242.4 |
Antigen-Antibody Pen For Mouse Primary antibodies |
PEN-M2 |
Alpha Diagnostics |
1 |
EUR 242.4 |
Antigen-Antibody Pen For Sheep Primary antibodies |
PEN-S4 |
Alpha Diagnostics |
1 |
EUR 242.4 |
ELISA Kit for Anti-Islet Cell Antibodies (ICA) |
AED246Hu |
Cloud-Clone |
96ΠΆ |
EUR 870 |
|